RetrogeneDB ID: | retro_meug_2091 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold8908:17844..18098(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C3orf14 | ||
Ensembl ID: | ENSMEUG00000013085 | ||
Aliases: | None | ||
Description: | chromosome 3 open reading frame 14 [Source:HGNC Symbol;Acc:25024] |
Percent Identity: | 68.18 % |
Parental protein coverage: | 65.89 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | GMAYFAKEVQLTKKHEEILAQRLL-LLEEMEKEHGGQKTEKK-ASYLKAAKLANKRNQSLLNDIRTLEEK |
GMA.FAKEV.LTKKHEEILAQRLL..LE.M...HG..KTEK...S.LK..KLANKRN.SLLNDIRT.EEK | |
Retrocopy | GMAHFAKEVRLTKKHEEILAQRLL<ILE*MKNDHGD*KTEKR<RSHLKLTKLANKRNLSLLNDIRTPEEK |
Parental | -LEKNAHLQSQIEMVNLQ |
.......LQ..IEM.NLQ | |
Retrocopy | >MXXXTYLQAHIEMFNLQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015374 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000007123 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004965 | 7 retrocopies | |
Erinaceus europaeus | ENSEEUG00000000474 | 1 retrocopy | |
Felis catus | ENSFCAG00000027983 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000013085 | 2 retrocopies |
retro_meug_1990, retro_meug_2091 ,
|
Microcebus murinus | ENSMICG00000016406 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000016914 | 1 retrocopy | |
Mus musculus | ENSMUSG00000033111 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008107 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000017312 | 1 retrocopy |