RetrogeneDB ID: | retro_meug_278 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | GeneScaffold_9227:50661..50827(+) | ||
Located in intron of: | ENSMEUG00000001358 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C15orf48 | ||
Ensembl ID: | ENSMEUG00000013137 | ||
Aliases: | None | ||
Description: | chromosome 15 open reading frame 48 [Source:HGNC Symbol;Acc:29898] |
Percent Identity: | 51.79 % |
Parental protein coverage: | 88.52 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MNIFQL-MMKKKELIPLITFATVGGVGAACMGL-YSLSKSDVIINKTTNPEPWENI |
MN..Q..MMKKKELI.LITF....G..AA.....YSL.K.D.I.N....PEP..N. | |
Retrocopy | MNLLQKRMMKKKELILLITFVSFMGFRAAYVSI>YSLFKTDMITNRKKIPEPGGNM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000031501 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000020706 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000003556 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000013137 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000029216 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000050251 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000021929 | 1 retrocopy |