RetrogeneDB ID: | retro_mluc_1022 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429788:6994919..6995154(-) | ||
| Located in intron of: | ENSMLUG00000005578 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNX24 | ||
| Ensembl ID: | ENSMLUG00000009392 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 87.34 % |
| Parental protein coverage: | 52.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | YLQAVILENEELPKLFLDFLNIRHLPSLPKAESCGSF-EETESEESSKLSHQPVLLFLRDPYVLPAASDF |
| .L.A.ILENEELPKLFL.FLNIRHLPSLPKAESCGSF.EETESEESSKLSHQ.VLL.L..PY.LPAASDF | |
| Retrocopy | HL*ADILENEELPKLFLHFLNIRHLPSLPKAESCGSF>EETESEESSKLSHQLVLLLLWNPYILPAASDF |
| Parental | PNVVIEGVL |
| PNVVIEGVL | |
| Retrocopy | PNVVIEGVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000031069 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000006859 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019810 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010310 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001708 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009392 | 2 retrocopies |
retro_mluc_1022 , retro_mluc_2330,
|
| Monodelphis domestica | ENSMODG00000013427 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005170 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000009785 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011329 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014395 | 2 retrocopies |