RetrogeneDB ID: | retro_mluc_1953 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL429961:1678944..1679155(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PMP2 | ||
Ensembl ID: | ENSMLUG00000009529 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 59.15 % |
Parental protein coverage: | 52.24 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | EISFKLGQEFEETTADNRKTKSVVTLVRGSLNQV-QKWDGKETTIKRKLVDGKMVVECKMKGVVCTRIYE |
EI.FKL..EF.ET.ADN.K.KS..TL..GSL..V.Q....KETTIKR...DGKMVV...M...V.TRIY. | |
Retrocopy | EIPFKLRKEFNETKADNQKVKSIITLDSGSLVHV>QNRLRKETTIKRQTLDGKMVVKHTMDTIVSTRIYQ |
Parental | K |
K | |
Retrocopy | K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000009514 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000009529 | 1 retrocopy |
retro_mluc_1953 ,
|
Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000012166 | 1 retrocopy | |
Oryzias latipes | ENSORLG00000008282 | 1 retrocopy |