RetrogeneDB ID: | retro_mmul_1130 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 14:128603747..128604179(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BAK1 | ||
Ensembl ID: | ENSMMUG00000009104 | ||
Aliases: | None | ||
Description: | bcl-2 homologous antagonist/killer [Source:RefSeq peptide;Acc:NP_001253660] |
Percent Identity: | 86.21 % |
Parental protein coverage: | 68.72 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | PSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGY |
PSST.GQVG.Q.AII.DDINRRYDSEF.TMLQHLQPTAENAYEYFTKIASSLFESGIN.GRVVALLGFGY | |
Retrocopy | PSSTVGQVGWQIAIIWDDINRRYDSEF*TMLQHLQPTAENAYEYFTKIASSLFESGINQGRVVALLGFGY |
Parental | RLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVR |
.L.LHVYQ.GLTGFLGQVTRFVV.FML.HCI..WIAQR..WVAAL.LGNGPILNVLV.LGVVLLG.FVV. | |
Retrocopy | HLVLHVYQRGLTGFLGQVTRFVV-FML*HCITWWIAQRSSWVAALDLGNGPILNVLVILGVVLLGLFVVQ |
Parental | RFFKS |
.FFKS | |
Retrocopy | GFFKS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 4 .71 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .60 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .49 RPM |
SRP007412_heart | 0 .00 RPM | 10 .83 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .20 RPM |
SRP007412_liver | 0 .00 RPM | 6 .45 RPM |
SRP007412_testis | 0 .00 RPM | 4 .15 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_942 |
Pan troglodytes | retro_ptro_652 |
Gorilla gorilla | retro_ggor_761 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Felis catus | ENSFCAG00000013657 | 1 retrocopy | |
Homo sapiens | ENSG00000030110 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000022462 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000009104 | 1 retrocopy |
retro_mmul_1130 ,
|
Nomascus leucogenys | ENSNLEG00000008351 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000001127 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000018053 | 1 retrocopy |