RetrogeneDB ID: | retro_mmul_1145 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 15:44200910..44201333(+) | ||
Located in intron of: | ENSMMUG00000007724 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LAGE3 | ||
Ensembl ID: | ENSMMUG00000007739 | ||
Aliases: | None | ||
Description: | L antigen family, member 3 [Source:HGNC Symbol;Acc:26058] |
Percent Identity: | 84.4 % |
Parental protein coverage: | 98.6 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | EAEADAGGGADGGDGQGGHSFPGGADTAAAPASGAPPPHAPGPGRDAASAARGPGMRPHIFTLSVPFPTP |
.A.ADAGG....GD.QG.HS.PGGADTAAAPA.GAPPPHA.GPGRDA.S.ARGPGMRPH.FTLSVPFPTP | |
Retrocopy | DADADAGGSTNCGDSQGDHSCPGGADTAAAPAGGAPPPHASGPGRDAKSVARGPGMRPHVFTLSVPFPTP |
Parental | LEAEIAHGSLAPDAEPHQRVVGKELTVSGRILAIRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVS |
LEAEIA.GSLAPDAEPHQRVVGK.L.VSGRILA.RW.AEDCRLLRISVINFLD.LSLVV.TMQ.FGPPVS | |
Retrocopy | LEAEIARGSLAPDAEPHQRVVGKNLAVSGRILAVRWEAEDCRLLRISVINFLDHLSLVVQTMQHFGPPVS |
Parental | R |
R | |
Retrocopy | R |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 5 .27 RPM |
SRP007412_brain_prefrontal_cortex | 1 .59 RPM | 14 .04 RPM |
SRP007412_cerebellum | 0 .19 RPM | 2 .78 RPM |
SRP007412_heart | 0 .65 RPM | 3 .71 RPM |
SRP007412_kidney | 0 .23 RPM | 6 .46 RPM |
SRP007412_liver | 4 .28 RPM | 10 .05 RPM |
SRP007412_testis | 11 .91 RPM | 1 .28 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000024143 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000009093 | 1 retrocopy | |
Homo sapiens | ENSG00000196976 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013507 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007739 | 1 retrocopy |
retro_mmul_1145 ,
|
Mus musculus | ENSMUSG00000015289 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000014285 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000003778 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000020881 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000037249 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000025528 | 1 retrocopy |