RetrogeneDB ID: | retro_dnov_244 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_2940:1978..2305(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000024143 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.05 % |
| Parental protein coverage: | 78.99 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GAPQAARAPHAPGSGGDAVPVAGGAGSRLLTFTLMVPFGSALEAEMACSSLMPDIHRQGQAVQKEITVNG |
| G...A.RA..A..SGG.A.P.A.G....L..F.L.VPF...LEAE.AC.SL.PD......A.QKE.TV.G | |
| Retrocopy | GSGDAERAALALASGGAAAPAARGPEGALHNFALSVPFPTPLEAEIACGSLAPDGEPHRAAIQKELTVAG |
| Parental | SVLAVRWTAEDLGILRISINTFCNQLSLIVWNIQRIGLP |
| .VLAVRWTAED...LRISI..F..QLSL.V...QR.G.P | |
| Retrocopy | GVLAVRWTAEDPRLLRISITNFLDQLSLVVRTMQRFGPP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 9 .72 RPM | 0 .00 RPM |
| SRP012922_cerebellum | 3 .99 RPM | 0 .00 RPM |
| SRP012922_heart | 2 .78 RPM | 0 .00 RPM |
| SRP012922_kidney | 20 .81 RPM | 0 .00 RPM |
| SRP012922_liver | 6 .66 RPM | 0 .00 RPM |
| SRP012922_lung | 8 .25 RPM | 0 .00 RPM |
| SRP012922_quadricep_muscle | 4 .50 RPM | 0 .00 RPM |
| SRP012922_spleen | 8 .93 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000024143 | 1 retrocopy |
retro_dnov_244 ,
|
| Dipodomys ordii | ENSDORG00000009093 | 1 retrocopy | |
| Homo sapiens | ENSG00000196976 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013507 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007739 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015289 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014285 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003778 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000020881 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000037249 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025528 | 1 retrocopy |