RetrogeneDB ID: | retro_mmul_2184 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 7:121468827..121469055(+) | ||
Located in intron of: | ENSMMUG00000001084 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.1138 | ||
Ensembl ID: | ENSMMUG00000020115 | ||
Aliases: | None | ||
Description: | heat shock factor-binding protein 1 [Source:RefSeq peptide;Acc:NP_001244973] |
Percent Identity: | 86.84 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELEGENKI |
MA.TDPKT.QDLTSVV.T.LQQ.QDKFQTMSDQIIGRIDDMSS.IDDLEKNI...MTQAGVEELEGENKI | |
Retrocopy | MAKTDPKTLQDLTSVV*TPLQQTQDKFQTMSDQIIGRIDDMSSHIDDLEKNITNPMTQAGVEELEGENKI |
Parental | PATQKS |
PAT.KS | |
Retrocopy | PATHKS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 16 .70 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 40 .38 RPM |
SRP007412_cerebellum | 0 .06 RPM | 16 .40 RPM |
SRP007412_heart | 0 .00 RPM | 30 .03 RPM |
SRP007412_kidney | 0 .00 RPM | 30 .16 RPM |
SRP007412_liver | 0 .00 RPM | 20 .70 RPM |
SRP007412_testis | 0 .08 RPM | 160 .01 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_920 |