RetrogeneDB ID: | retro_mmul_2405 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 9:61627479..61627916(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.3661 | ||
| Ensembl ID: | ENSMMUG00000008480 | ||
| Aliases: | None | ||
| Description: | sperm autoantigenic protein 17 [Source:RefSeq peptide;Acc:NP_001165553] |
| Percent Identity: | 82.31 % |
| Parental protein coverage: | 96.69 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIP-AFAAAYFESLLEKREKTNFDPAEWGSKVEDRFY |
| MSIPFSNTHY.I.QGFG.LLEGLT.EILREQ.DNI..AFAAAYFES.LE.REKT.FDPAEWG..VEDRF. | |
| Retrocopy | MSIPFSNTHY*ILQGFGSLLEGLTHEILREQLDNIQ<AFAAAYFESFLENREKTTFDPAEWGTQVEDRF* |
| Parental | NNHAFEEQEPPEKSDPKQEESQIPGKEEEASVTILDSSEEDKEKEEVAAVKIQAAFRGHVAREEVKKMKT |
| N.HAFEEQEPPEK.DPKQE.S.I.GKEEE..VTILDSSEEDKEKEEVAAVKIQAAF.GH.AREEV..M.T | |
| Retrocopy | NSHAFEEQEPPEKCDPKQENSPISGKEEETPVTILDSSEEDKEKEEVAAVKIQAAFWGHIAREEVRRMET |
| Parental | DSLQNEE |
| DSLQ.EE | |
| Retrocopy | DSLQLEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 3 .03 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .06 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .71 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .65 RPM |
| SRP007412_kidney | 0 .00 RPM | 2 .11 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .26 RPM | 231 .17 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_696 |
| Pan troglodytes | retro_ptro_500 |
| Gorilla gorilla | retro_ggor_593 |
| Pongo abelii | retro_pabe_529 |
| Callithrix jacchus | retro_cjac_978 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007961 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007789 | 1 retrocopy | |
| Homo sapiens | ENSG00000064199 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003757 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008480 | 1 retrocopy |
retro_mmul_2405 ,
|
| Nomascus leucogenys | ENSNLEG00000007436 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004017 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004426 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008379 | 1 retrocopy |