RetrogeneDB ID: | retro_mmul_655 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 10:88482282..88482501(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPS18C | ||
Ensembl ID: | ENSMMUG00000015353 | ||
Aliases: | None | ||
Description: | 28S ribosomal protein S18c, mitochondrial [Source:RefSeq peptide;Acc:NP_001253055] |
Percent Identity: | 71.43 % |
Parental protein coverage: | 52.08 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | CILCGKRVDYKNVQLLSQFVSPFTGCIYGRHITGLCG-KKQKEITKAIKRAQILGFMPVTYKD-PAYLKD |
CILCGK.VD.KN.QLLS.F.SPFTGCIYGR.ITGLCG....K......KRAQI.GFMP.TY.D..AYLKD | |
Retrocopy | CILCGKHVDDKNIQLLSHFISPFTGCIYGRYITGLCG>RNRKKLQN--KRAQIMGFMPATYED<SAYLKD |
Parental | PKVCNIR |
PKV.NIR | |
Retrocopy | PKVSNIR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .22 RPM | 11 .21 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .03 RPM |
SRP007412_cerebellum | 0 .00 RPM | 10 .98 RPM |
SRP007412_heart | 0 .00 RPM | 10 .72 RPM |
SRP007412_kidney | 0 .00 RPM | 13 .15 RPM |
SRP007412_liver | 0 .00 RPM | 10 .33 RPM |
SRP007412_testis | 0 .00 RPM | 13 .76 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2597 |
Pan troglodytes | retro_ptro_1521 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000018155 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000005286 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000009198 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000018326 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000010972 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000017057 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015353 | 4 retrocopies | |
Mus musculus | ENSMUSG00000016833 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000009119 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000004113 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000025867 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000006439 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000002178 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000007084 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000007989 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000012505 | 3 retrocopies | |
Tarsius syrichta | ENSTSYG00000012924 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000004897 | 2 retrocopies |