RetrogeneDB ID: | retro_mmul_764 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 1099548049653:199457..199893(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.12033 | ||
Ensembl ID: | ENSMMUG00000005321 | ||
Aliases: | None | ||
Description: | carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 [Source:RefSeq peptide;Acc:NP_001252987] |
Percent Identity: | 75.68 % |
Parental protein coverage: | 51.42 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | MEHGSIITQARREDALVLTKQGLVSK-SSPKKPRGRNI-FKALFCCFRAQHVGQSSSSTELAAYKEEANT |
MEHGSIIT.A.REDALVLTKQGLVSK.SSPK......I..KA.FC....QHVGQSSS.TEL...KEEANT | |
Retrocopy | MEHGSIIT*ACREDALVLTKQGLVSK>SSPKSLHVCHI>YKAPFCRSCTQHVGQSSSLTELSTHKEEANT |
Parental | IAKSDLLQCLQYQFYQIPGTCLLP-EVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQ |
.AKSD.LQ.LQYQ.YQIPGT.LLP..VTEEDQGRIC.V.DLDETLVHSSFKPI.NAD..VP.EIEGTTH. | |
Retrocopy | TAKSDHLQGLQYQLYQIPGTYLLP<KVTEEDQGRICMVTDLDETLVHSSFKPISNADSLVPVEIEGTTHH |
Parental | VYVLKRPY |
..VLKRPY | |
Retrocopy | IHVLKRPY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 95 .69 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 120 .90 RPM |
SRP007412_cerebellum | 0 .00 RPM | 154 .79 RPM |
SRP007412_heart | 0 .00 RPM | 125 .90 RPM |
SRP007412_kidney | 0 .00 RPM | 189 .67 RPM |
SRP007412_liver | 0 .12 RPM | 132 .01 RPM |
SRP007412_testis | 0 .00 RPM | 125 .10 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006503 | 2 retrocopies | |
Homo sapiens | ENSG00000175215 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000005321 | 2 retrocopies |
retro_mmul_2208, retro_mmul_764 ,
|
Macaca mulatta | ENSMMUG00000016742 | 1 retrocopy | |
Mus musculus | ENSMUSG00000078429 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017164 | 2 retrocopies | |
Petromyzon marinus | ENSPMAG00000009544 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000004711 | 14 retrocopies | |
Pan troglodytes | ENSPTRG00000005155 | 7 retrocopies |