RetrogeneDB ID: | retro_mmus_1045 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 13:85516403..85516619(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ppp1r14b | ||
| Ensembl ID: | ENSMUSG00000056612 | ||
| Aliases: | Ppp1r14b, AOM172, PHI-1, PLCB3N, Png | ||
| Description: | protein phosphatase 1, regulatory (inhibitor) subunit 14B [Source:MGI Symbol;Acc:MGI:107682] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 51.02 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | GKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDTRAARVKE-LLVDCYK |
| GKVTVKY..KE..K.LNLEEW...QLTRL..C.EEEIPEL.IDVD....MESDD..AARVKE.LLVDCYK | |
| Retrocopy | GKVTVKYHSKEVWKCLNLEEWMFQQLTRLNVC*EEEIPELKIDVD----MESDDIWAARVKELLLVDCYK |
| Parental | PTEAFI |
| PTEAFI | |
| Retrocopy | PTEAFI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .72 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .43 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .52 RPM |
| SRP007412_kidney | 0 .00 RPM | 9 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .36 RPM |
| SRP007412_testis | 0 .00 RPM | 27 .86 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000018019 | 1 retrocopy | |
| Felis catus | ENSFCAG00000030667 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000040653 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000056612 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030926 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000017120 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000021151 | 2 retrocopies |