RetrogeneDB ID: | retro_mmus_1779 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 18:60507445..60507718(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rheb | ||
Ensembl ID: | ENSMUSG00000028945 | ||
Aliases: | None | ||
Description: | Ras homolog enriched in brain [Source:MGI Symbol;Acc:MGI:97912] |
Percent Identity: | 57.89 % |
Parental protein coverage: | 50.54 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | KSSLTIQFVEGQFVDSYDPTIENTFTKLITVNG-QEYHLQLVDTAGQDEYSI-FPQTYSIDINGYILVYS |
KSS.TIQ.V...FVDSYD...E.T..K.I.VNG.Q...LQL.D.AGQ.EY...FPQTY.I.IN.Y.LV.. | |
Retrocopy | KSS*TIQVVDC*FVDSYDRITESTPPKSIPVNG>QDCSLQLADAAGQEEYPV<FPQTYFIEIN*YVLVDC |
Parental | VTSIKSFEVIKVIHGKLLDMVGKVQ |
....K.FEV..V..GKLLD.V.KVQ | |
Retrocopy | YS--KGFEVTNVSYGKLLDVVEKVQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 64 .55 RPM |
SRP007412_cerebellum | 0 .04 RPM | 60 .75 RPM |
SRP007412_heart | 0 .00 RPM | 49 .40 RPM |
SRP007412_kidney | 0 .00 RPM | 53 .59 RPM |
SRP007412_liver | 0 .00 RPM | 34 .55 RPM |
SRP007412_testis | 0 .09 RPM | 12 .58 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000031861 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000020414 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000007541 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000016493 | 1 retrocopy | |
Homo sapiens | ENSG00000106615 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000014675 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000000691 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000011774 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004309 | 2 retrocopies | |
Mus musculus | ENSMUSG00000028945 | 1 retrocopy |
retro_mmus_1779 ,
|
Oryctolagus cuniculus | ENSOCUG00000013173 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000004544 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000001286 | 2 retrocopies |