RetrogeneDB ID: | retro_ocun_1517 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 9:83210594..83210830(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP5J | ||
Ensembl ID: | ENSOCUG00000006681 | ||
Aliases: | None | ||
Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6 [Source:HGNC Symbol;Acc:847] |
Percent Identity: | 76.25 % |
Parental protein coverage: | 73.15 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | VAFNKELDPVQKLFVDKIREYKSKRQASGGPVDAGPSYQQDLEK-ELFKLKQMFGKADMNTFPTFKFEDP |
.AFNKE.DPVQKLFVD.IRE.KSK.QASGGPVDAG...QQDL...EL.KLKQMF.K.DMN.FP.F.FEDP | |
Retrocopy | LAFNKEIDPVQKLFVDNIREHKSKQQASGGPVDAG*VCQQDLDG<ELLKLKQMFVK*DMNMFPAFEFEDP |
Parental | KFETIEKPQS |
.FETIEK.QS | |
Retrocopy | NFETIEKSQS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 19 .59 RPM |
SRP017611_kidney | 0 .00 RPM | 54 .94 RPM |
SRP017611_liver | 0 .00 RPM | 7 .17 RPM |