RetrogeneDB ID: | retro_ogar_2682 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873647.1:5894214..5894518(+) | ||
| Located in intron of: | ENSOGAG00000013155 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2E3 | ||
| Ensembl ID: | ENSOGAG00000014956 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2E 3 [Source:HGNC Symbol;Acc:12479] |
| Percent Identity: | 57.41 % |
| Parental protein coverage: | 50.24 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | KLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNI-YEWRSTILGP-PGSVYEGGVFF-LDITF |
| KLSSKTTA.LS..AK..Q..L.....D....CS.GP.......EW.S..LGP.PGS...GGVFF.LD..F | |
| Retrocopy | KLSSKTTARLSIGAKGTQ--LSQNHPDSLLCCSPGPDKVTV<HEWQSAALGP<PGSMF*GGVFF>LDVAF |
| Parental | SSDYPFK-PPKVTFRTRIYHCNINSQGVICLDILKDNW |
| SSDYPFK..PK.TF.TR..H.NI.SQGV.CL...KDNW | |
| Retrocopy | SSDYPFK<APKLTFCTRVSHYNISSQGVLCLNSFKDNW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014163 | 3 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007325 | 3 retrocopies | |
| Ciona intestinalis | ENSCING00000006860 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011559 | 3 retrocopies | |
| Equus caballus | ENSECAG00000007233 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019324 | 2 retrocopies | |
| Homo sapiens | ENSG00000170035 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008069 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000010301 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000027011 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006290 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007527 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012860 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000014956 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000012987 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004544 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000009932 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002281 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001361 | 1 retrocopy |