RetrogeneDB ID: | retro_ogar_2682 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873647.1:5894214..5894518(+) | ||
Located in intron of: | ENSOGAG00000013155 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2E3 | ||
Ensembl ID: | ENSOGAG00000014956 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2E 3 [Source:HGNC Symbol;Acc:12479] |
Percent Identity: | 57.41 % |
Parental protein coverage: | 50.24 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | KLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNI-YEWRSTILGP-PGSVYEGGVFF-LDITF |
KLSSKTTA.LS..AK..Q..L.....D....CS.GP.......EW.S..LGP.PGS...GGVFF.LD..F | |
Retrocopy | KLSSKTTARLSIGAKGTQ--LSQNHPDSLLCCSPGPDKVTV<HEWQSAALGP<PGSMF*GGVFF>LDVAF |
Parental | SSDYPFK-PPKVTFRTRIYHCNINSQGVICLDILKDNW |
SSDYPFK..PK.TF.TR..H.NI.SQGV.CL...KDNW | |
Retrocopy | SSDYPFK<APKLTFCTRVSHYNISSQGVLCLNSFKDNW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000014163 | 3 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000007325 | 3 retrocopies | |
Ciona intestinalis | ENSCING00000006860 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011559 | 3 retrocopies | |
Equus caballus | ENSECAG00000007233 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019324 | 2 retrocopies | |
Homo sapiens | ENSG00000170035 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000008069 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000010301 | 2 retrocopies | |
Mus musculus | ENSMUSG00000027011 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006290 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000007527 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000012860 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000014956 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000012987 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000004544 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000009932 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000002281 | 5 retrocopies | |
Tursiops truncatus | ENSTTRG00000001361 | 1 retrocopy |