RetrogeneDB ID: | retro_ogar_774 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873527.1:6046483..6046707(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSOGAG00000027513 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPE | ||
| Ensembl ID: | ENSOGAG00000004309 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
| Percent Identity: | 82.89 % |
| Parental protein coverage: | 98.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYE-QVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTK |
| .AY.GQGQKVQKVMVQ.INLIFRYLQNRSR.Q.WLY..QV.M..EG.IIG.DEYMNLVLDDAEEIHSKTK | |
| Retrocopy | VAYCGQGQKVQKVMVQLINLIFRYLQNRSRVQLWLYD<QVDMWMEGYIIGVDEYMNLVLDDAEEIHSKTK |
| Parental | SRKQLG |
| SR.QLG | |
| Retrocopy | SRRQLG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |