RetrogeneDB ID: | retro_ggor_2221 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 5:144414488..144414692(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENSG00000182004 | ||
Ensembl ID: | ENSGGOG00000000755 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 88.24 % |
Parental protein coverage: | 73.91 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN |
LQNRSRIQVWLYEQVNMRIEGCII.FDEYMNLVLDDAEEIHSKTKS...L.RIMLKG.NITLL.S.SN | |
Retrocopy | LQNRSRIQVWLYEQVNMRIEGCIISFDEYMNLVLDDAEEIHSKTKS*IRLSRIMLKGHNITLLRSFSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .30 RPM |
SRP007412_cerebellum | 0 .04 RPM | 10 .36 RPM |
SRP007412_heart | 0 .00 RPM | 3 .78 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .85 RPM |
SRP007412_liver | 0 .00 RPM | 13 .16 RPM |
SRP007412_testis | 0 .00 RPM | 18 .96 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3262 |
Pan troglodytes | retro_ptro_2206 |
Macaca mulatta | retro_mmul_2054 |