RetrogeneDB ID: | retro_dnov_513 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_5550:3208..3442(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000004490 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.5 % |
Parental protein coverage: | 86.96 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGD |
.MV.P..L.F..LQN.SR....LYEQVNM.IEGCI.GFDEYMNLVLDDAEEI.....SRKQLG.IMLKGD | |
Retrocopy | LMVVPTFLFFLNLQNISRXXXXLYEQVNMWIEGCITGFDEYMNLVLDDAEEI--LKQSRKQLGWIMLKGD |
Parental | NITLLQSVSN |
N.TLL.SVSN | |
Retrocopy | NTTLLHSVSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .19 RPM | 23 .92 RPM |
SRP012922_cerebellum | 0 .00 RPM | 12 .51 RPM |
SRP012922_heart | 0 .00 RPM | 8 .59 RPM |
SRP012922_kidney | 0 .00 RPM | 9 .31 RPM |
SRP012922_liver | 0 .00 RPM | 7 .43 RPM |
SRP012922_lung | 0 .00 RPM | 15 .27 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 8 .13 RPM |
SRP012922_spleen | 0 .00 RPM | 24 .15 RPM |