RetrogeneDB ID: | retro_pabe_1167 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 14:45119092..45119397(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DDA1 | ||
| Ensembl ID: | ENSPPYG00000009710 | ||
| Aliases: | None | ||
| Description: | DET1- and DDB1-associated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5RD86] |
| Percent Identity: | 89.32 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQW-DKKNAA |
| MADFLKGLPVYNKSNFSRFH.DSVCKASN..PSVYLPTREYPSEQIIVTEKTNILLRY.HQQW.DKKNAA | |
| Retrocopy | MADFLKGLPVYNKSNFSRFHGDSVCKASNQWPSVYLPTREYPSEQIIVTEKTNILLRYQHQQW<DKKNAA |
| Parental | KKRDQEQVELEGESSAPPRKVARTDSPDMHEDT |
| KK.DQEQVELEGE.SAP.RKVA.T.SP.MHEDT | |
| Retrocopy | KKKDQEQVELEGETSAPLRKVALTHSPEMHEDT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 26 .15 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .18 RPM |
| SRP007412_kidney | 0 .03 RPM | 8 .88 RPM |
| SRP007412_liver | 0 .06 RPM | 5 .54 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1409 |
| Pan troglodytes | retro_ptro_966 |
| Gorilla gorilla | retro_ggor_1093 |
| Macaca mulatta | retro_mmul_2248 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000017068 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000031251 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000006944 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001001 | 1 retrocopy | |
| Homo sapiens | ENSG00000130311 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005802 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001763 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003990 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016231 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005738 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003701 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009710 | 2 retrocopies |
retro_pabe_1167 , retro_pabe_1214,
|
| Pan troglodytes | ENSPTRG00000010668 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000039417 | 1 retrocopy |