RetrogeneDB ID: | retro_pabe_1940 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 2a:34982290..34982494(+) | ||
Located in intron of: | ENSPPYG00000012255 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUPT4H1 | ||
Ensembl ID: | ENSPPYG00000008233 | ||
Aliases: | None | ||
Description: | transcription elongation factor SPT4 [Source:RefSeq peptide;Acc:NP_001129015] |
Percent Identity: | 88.24 % |
Parental protein coverage: | 58.12 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | EMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTA |
EMVYDCTSSSFDGIIAMMSPEDS.VSKWQRV.NFKPG.YAVS.TG.LPQGIV.ELKSRG..YKSRDTA | |
Retrocopy | EMVYDCTSSSFDGIIAMMSPEDS*VSKWQRVTNFKPGTYAVSFTGHLPQGIV*ELKSRGATYKSRDTA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 50 .43 RPM |
SRP007412_cerebellum | 0 .00 RPM | 51 .32 RPM |
SRP007412_heart | 0 .00 RPM | 26 .25 RPM |
SRP007412_kidney | 0 .13 RPM | 49 .69 RPM |
SRP007412_liver | 0 .03 RPM | 40 .33 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2280 |
Pan troglodytes | retro_ptro_1614 |
Gorilla gorilla | retro_ggor_1693 |
Callithrix jacchus | retro_cjac_1196 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000017524 | 2 retrocopies | |
Homo sapiens | ENSG00000213246 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007232 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000010164 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000025583 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007579 | 2 retrocopies | |
Mus musculus | ENSMUSG00000020485 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008159 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000025823 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000008233 | 1 retrocopy |
retro_pabe_1940 ,
|
Pan troglodytes | ENSPTRG00000009451 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002320 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000007845 | 3 retrocopies |