RetrogeneDB ID: | retro_rnor_1973 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 4:62670739..62670947(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Supt4h1 | ||
Ensembl ID: | ENSRNOG00000007845 | ||
Aliases: | Supt4h1, Supt4h2 | ||
Description: | suppressor of Ty 4 homolog 1 [Source:RefSeq peptide;Acc:NP_001099298] |
Percent Identity: | 82.86 % |
Parental protein coverage: | 58.97 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDG-IIAMMSPEDS |
MALETV.KDLRHLR.CLLCSLVKTID.FE.D.CDNCDAYLQ.KGNREMVYDCTSSSFDG.IIAM.....S | |
Retrocopy | MALETVRKDLRHLRVCLLCSLVKTID*FECDRCDNCDAYLQVKGNREMVYDCTSSSFDG>IIAMSAGSPS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 17 .90 RPM |
SRP017611_kidney | 0 .00 RPM | 19 .19 RPM |
SRP017611_liver | 0 .00 RPM | 13 .38 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000017524 | 2 retrocopies | |
Homo sapiens | ENSG00000213246 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007232 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000010164 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000025583 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007579 | 2 retrocopies | |
Mus musculus | ENSMUSG00000020485 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008159 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000025823 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000008233 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000009451 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002320 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000007845 | 3 retrocopies |
retro_rnor_1255, retro_rnor_1973 , retro_rnor_556,
|