RetrogeneDB ID: | retro_pabe_2310 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3:67771652..67772080(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSPPYG00000013705 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HINT2 | ||
Ensembl ID: | ENSPPYG00000019082 | ||
Aliases: | None | ||
Description: | histidine triad nucleotide binding protein 2 [Source:HGNC Symbol;Acc:18344] |
Percent Identity: | 72.97 % |
Parental protein coverage: | 90.18 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | KAVAATGARGGQVRGAAGVTDGNEVAKSQQATPGGAAPTIFSRILDRSLPADILYEDQQCLVFRDVAPQA |
.A.AATG.R.....GA.GVT.GNE..K.Q.A.PGG.APTIF..ILD..LPA.ILYED.QCLVF.DVAP.A | |
Retrocopy | RAMAATGLRSTHI*GAVGVTGGNEMTKAQRALPGGVAPTIFCGILDHRLPAYILYED*QCLVFPDVAP*A |
Parental | PVHFLVIPKKPIPRISQAEEED-QQLLGHLLLVAKKTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLG |
PVHFLVIPKKPIPRI.QAE.ED.QQLLGHLLLV.KK.A.AEGLGDGYRLVIND.....QSV..LHIH.LG | |
Retrocopy | PVHFLVIPKKPIPRINQAEQED<QQLLGHLLLVSKKIARAEGLGDGYRLVIND----EQSVNYLHIHLLG |
Parental | GRQLQWPP |
..QLQWPP | |
Retrocopy | S*QLQWPP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 13 .10 RPM |
SRP007412_cerebellum | 0 .00 RPM | 8 .76 RPM |
SRP007412_heart | 0 .06 RPM | 8 .94 RPM |
SRP007412_kidney | 0 .03 RPM | 55 .06 RPM |
SRP007412_liver | 0 .00 RPM | 14 .90 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2603 |
Pan troglodytes | retro_ptro_1754 |
Gorilla gorilla | retro_ggor_1823 |
Macaca mulatta | retro_mmul_1509 |
Callithrix jacchus | retro_cjac_1343 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000011444 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000010068 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000419 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009083 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000017929 | 1 retrocopy | |
Homo sapiens | ENSG00000137133 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011265 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000015022 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016337 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000026914 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027206 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000011830 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015747 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000019082 | 1 retrocopy |
retro_pabe_2310 ,
|
Pan troglodytes | ENSPTRG00000020923 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000003028 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013020 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000002700 | 7 retrocopies | |
Tursiops truncatus | ENSTTRG00000011932 | 1 retrocopy |