RetrogeneDB ID: | retro_dnov_854 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_114504:3159..3486(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HINT2 | ||
Ensembl ID: | ENSDNOG00000009083 | ||
Aliases: | None | ||
Description: | histidine triad nucleotide binding protein 2 [Source:HGNC Symbol;Acc:18344] |
Percent Identity: | 51.38 % |
Parental protein coverage: | 80.15 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | IFSRILDRSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDEQLLGHLLLVAKKAAKA |
.F..I.....P..I..ED..CL.F.D..PQ.P.HFLVIPKK....IS..EE.DE.LLGHL..V.KK.A.. | |
Retrocopy | LFGKIICKEIPTKIIFEDN*CLAFQDISPQTPTHFLVIPKKHVCQISIEEESDERLLGHLMIVVKKCAAD |
Parental | EGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG |
.GL..G...V.N.G..G.QSV...H.HVL.GRQ..WP.G | |
Retrocopy | LGLKRGF*MVVNEGSDGGQSVHRVHLHVLEGRQMSWPSG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .58 RPM | 29 .75 RPM |
SRP012922_cerebellum | 1 .24 RPM | 21 .58 RPM |
SRP012922_heart | 0 .46 RPM | 30 .63 RPM |
SRP012922_kidney | 2 .19 RPM | 134 .71 RPM |
SRP012922_liver | 0 .31 RPM | 74 .93 RPM |
SRP012922_lung | 2 .14 RPM | 50 .09 RPM |
SRP012922_quadricep_muscle | 0 .35 RPM | 11 .60 RPM |
SRP012922_spleen | 1 .95 RPM | 33 .31 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000011444 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000010068 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000419 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009083 | 2 retrocopies |
retro_dnov_201, retro_dnov_854 ,
|
Echinops telfairi | ENSETEG00000017929 | 1 retrocopy | |
Homo sapiens | ENSG00000137133 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011265 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000015022 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016337 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000026914 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027206 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000011830 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000019082 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000020923 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000003028 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013020 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000002700 | 7 retrocopies | |
Tursiops truncatus | ENSTTRG00000011932 | 1 retrocopy |