RetrogeneDB ID: | retro_pabe_2378 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:164646274..164646706(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EEF1G | ||
| Ensembl ID: | ENSPPYG00000029434 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation elongation factor 1 gamma [Source:HGNC Symbol;Acc:3213] |
| Percent Identity: | 68.24 % |
| Parental protein coverage: | 61.44 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | LADITVVCTLLWLYKQVLEPSFRQ-AFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPK |
| LADITVVCTLLWLYKQVLEPSF.Q.AF...N.W.LTCINQ.Q..AVL..VKL.EKMAQFDAK.......K | |
| Retrocopy | LADITVVCTLLWLYKQVLEPSFHQ<AFLSNNPWLLTCINQTQLWAVLE*VKLFEKMAQFDAKNSTDSPTK |
| Parental | KDT-PRKEKGSREEKQKPQAERKEEK-KAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKR |
| .DT.P.K..GS..EKQ.PQA..K.EK...A..A.EEEMDECEQALAAEPKAK..FA.LP..TFVL.EF.. | |
| Retrocopy | NDT<PWKGRGSLKEKQMPQAKQKQEK<NVASLASEEEMDECEQALAAEPKAKGLFAQLPEGTFVLGEFIP |
| Parental | KYSNEDTL |
| K.S.EDTL | |
| Retrocopy | KCSSEDTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 205 .63 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 127 .19 RPM |
| SRP007412_heart | 0 .00 RPM | 351 .76 RPM |
| SRP007412_kidney | 0 .00 RPM | 555 .94 RPM |
| SRP007412_liver | 0 .00 RPM | 381 .94 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1992 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006745 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015834 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000018949 | 6 retrocopies | |
| Equus caballus | ENSECAG00000014334 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000014700 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003339 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007691 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013942 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003528 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000020959 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000029434 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000003768 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020075 | 8 retrocopies |