RetrogeneDB ID: | retro_pvam_460 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | GeneScaffold_3254:166165..166343(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COA5 | ||
Ensembl ID: | ENSPVAG00000001578 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase assembly factor 5 [Source:HGNC Symbol;Acc:33848] |
Percent Identity: | 61.67 % |
Parental protein coverage: | 79.73 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | GVKEDLGACLLQSDCVLQEGKSPRQCLKEGNCKA-LKYSFFECKRSMLDARSRFRGRKGY |
GV...LG..LLQ..CVLQ.GK.P.QC.KE.N.K..L.Y..F.C..SMLDAR..FRGRKGY | |
Retrocopy | GVQGALGTRLLQEGCVLQKGKAPPQCPKEQNTKV>LQYPLFKCRISMLDARPKFRGRKGY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007139 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000009263 | 1 retrocopy | |
Equus caballus | ENSECAG00000004183 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000013626 | 1 retrocopy | |
Felis catus | ENSFCAG00000004424 | 1 retrocopy | |
Homo sapiens | ENSG00000183513 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006019 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000013167 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000001197 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001998 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002972 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000012085 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012267 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000001578 | 1 retrocopy |
retro_pvam_460 ,
|
Sorex araneus | ENSSARG00000006275 | 1 retrocopy |