RetrogeneDB ID: | retro_sara_61 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | GeneScaffold_1785:3741..3957(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COA5 | ||
Ensembl ID: | ENSSARG00000006275 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase assembly factor 5 [Source:HGNC Symbol;Acc:33848] |
Percent Identity: | 58.11 % |
Parental protein coverage: | 97.3 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | RYYEDKPEEGACAGVKEDLGACLLRSDCVLQEGK-SPRQCLKEGNCKALKY-SFFECKRSMLDARSRFRG |
RY.E.K.EEG.C..VK.DLG.CLL.SD..LQ.GK..P..CL.E.N.KALKY..F......M...RSRF.G | |
Retrocopy | RYEENKVEEGVCTWVKKDLGVCLLNSDDPLQKGK<APSLCLEESNRKALKY>CFV*YEETMSGTRSRFKG |
Parental | RKGY |
RKGY | |
Retrocopy | RKGY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007139 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000009263 | 1 retrocopy | |
Equus caballus | ENSECAG00000004183 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000013626 | 1 retrocopy | |
Felis catus | ENSFCAG00000004424 | 1 retrocopy | |
Homo sapiens | ENSG00000183513 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006019 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000013167 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000001197 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001998 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002972 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000012085 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012267 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000001578 | 1 retrocopy | |
Sorex araneus | ENSSARG00000006275 | 1 retrocopy |
retro_sara_61 ,
|