RetrogeneDB ID: | retro_pvam_92 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | GeneScaffold_131:56614..56870(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPVAG00000003521 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 58.14 % |
Parental protein coverage: | 56.43 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | MPKNKGKGGKN--RRRGKNENESEKRELVFKEDGQEYAQVIKML-GNGRLEAMCFDGVKRLCHIRGKLRK |
MPKNKGKGGKN..R.R..........ELV.KED....AQVIKML.G...LEAM.FDG.KRLCHI.GKLR. | |
Retrocopy | MPKNKGKGGKNKCRVRMRINLXXXXXELVYKEDE*G*AQVIKML>GKRLLEAMFFDGIKRLCHIKGKLRE |
Parental | ----KTSDIILVGLRD |
......SD..LV.L.D | |
Retrocopy | MI*INISDMVLVDLPD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000005371 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011536 | 1 retrocopy | |
Homo sapiens | ENSG00000173674 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000012186 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000012977 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000027820 | 1 retrocopy | |
Mus musculus | ENSMUSG00000067194 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008182 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000022504 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000003521 | 2 retrocopies |
retro_pvam_780, retro_pvam_92 ,
|
Rattus norvegicus | ENSRNOG00000005736 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000029864 | 1 retrocopy |