RetrogeneDB ID: | retro_rnor_1318 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 17:68250571..68250779(-) | ||
Located in intron of: | ENSRNOG00000018046 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Hmgn1 | ||
Ensembl ID: | ENSRNOG00000050978 | ||
Aliases: | None | ||
Description: | high-mobility group nucleosome binding domain 1 [Source:RefSeq peptide;Acc:NP_001013202] |
Percent Identity: | 67.61 % |
Parental protein coverage: | 72.92 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MPKRKVSADGAAKAEPKRRSARLSAKP-APAKVDAKPKKAAGKDKASDKKAQIKGKRGAKGKQAEVADQQ |
.PKRK.S.D.A.KAEPK..S.RLSAKP.APAKVD.KP.K.....K.SDKK.QIKGKR.AKGKQA.VAD.. | |
Retrocopy | VPKRKISVDRAMKAEPKLHSLRLSAKP>APAKVDRKPEKWE-RIKTSDKKVQIKGKREAKGKQADVADYR |
Parental | T |
. | |
Retrocopy | S |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000002336 | 7 retrocopies | |
Monodelphis domestica | ENSMODG00000020972 | 5 retrocopies | |
Mustela putorius furo | ENSMPUG00000008550 | 3 retrocopies | |
Mus musculus | ENSMUSG00000040681 | 13 retrocopies | |
Rattus norvegicus | ENSRNOG00000048226 | 8 retrocopies | |
Rattus norvegicus | ENSRNOG00000050978 | 5 retrocopies |