RetrogeneDB ID: | retro_rnor_1890 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 3:66903636..66903837(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rbx1 | ||
| Ensembl ID: | ENSRNOG00000019214 | ||
| Aliases: | None | ||
| Description: | RING-box protein 1 [Source:RefSeq peptide;Acc:NP_001029307] |
| Percent Identity: | 65.22 % |
| Parental protein coverage: | 61.11 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MAAAMDVDTPSGTNS-GAGKKRFEVKKWNAVALW-AWDIVVDN-CAICRNHIMDLCIECQANQASATSE |
| M.AAM..DT.S..NS.G.GKK.F.VK.W.AVALW.AW.IVVD..CAICRNHI.D.C.EC..N..SATS. | |
| Retrocopy | MVAAMGLDTRSVNNS>G*GKKHF*VKRWKAVALW<AWEIVVDGICAICRNHIVDFCTECRVNPVSATSK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 24 .88 RPM |
| SRP017611_kidney | 0 .00 RPM | 26 .45 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .94 RPM |