RetrogeneDB ID: | retro_rnor_2262 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 5:150898989..150899321(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rnf7 | ||
Ensembl ID: | ENSRNOG00000011663 | ||
Aliases: | None | ||
Description: | RING-box protein 2 [Source:RefSeq peptide;Acc:NP_001100318] |
Percent Identity: | 83.19 % |
Parental protein coverage: | 99.12 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ- |
ADVEDGEEPC.L.SHSGSAGSK.GG.K.FSLKKWN.VAMWSWDVEC.T.AICRVQ..DACLRCQAENK.. | |
Retrocopy | ADVEDGEEPCLLFSHSGSAGSKLGGHKIFSLKKWNGVAMWSWDVECKTFAICRVQETDACLRCQAENKR< |
Parental | EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
EDC.VVWG.CNHSFHN.C.SLWVK..NRCPLCQQDWV.QRIGK | |
Retrocopy | EDCDVVWGGCNHSFHN-CGSLWVKRDNRCPLCQQDWVAQRIGK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 6 .54 RPM |
SRP017611_kidney | 0 .00 RPM | 14 .44 RPM |
SRP017611_liver | 0 .00 RPM | 5 .24 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000007694 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000010742 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000001991 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000005961 | 3 retrocopies | |
Homo sapiens | ENSG00000114125 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001829 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000001353 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006648 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000021232 | 1 retrocopy | |
Mus musculus | ENSMUSG00000051234 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004646 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000008659 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014167 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000039248 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000011663 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000019214 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000014964 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000002917 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000007778 | 5 retrocopies |