RetrogeneDB ID: | retro_rnor_1950 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 4:9940513..9940930(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSRNOG00000012776 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Arf1 | ||
| Ensembl ID: | ENSRNOG00000030591 | ||
| Aliases: | None | ||
| Description: | ADP-ribosylation factor 1 [Source:RefSeq peptide;Acc:NP_071963] |
| Percent Identity: | 88.65 % |
| Parental protein coverage: | 77.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRM |
| EIVTTIPT.GFNVETVEYKNI.FTVWDVGGQDKIRPLWRH.FQNTQG..FVV.SNDR.RVNEA.EEL..M | |
| Retrocopy | EIVTTIPTTGFNVETVEYKNIGFTVWDVGGQDKIRPLWRHHFQNTQGSVFVVGSNDRQRVNEACEELRTM |
| Parental | LAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ |
| L.EDEL.DAVLLVFANKQDLP..MN.AEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR.Q | |
| Retrocopy | LTEDELQDAVLLVFANKQDLP--MNVAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRSQ |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 281 .04 RPM |
| SRP017611_kidney | 0 .00 RPM | 278 .71 RPM |
| SRP017611_liver | 0 .00 RPM | 162 .65 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anas platyrhynchos | ENSAPLG00000004509 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016671 | 10 retrocopies | |
| Ciona savignyi | ENSCSAVG00000007011 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000005393 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000019009 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007020 | 6 retrocopies | |
| Macaca mulatta | ENSMMUG00000002792 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014137 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000023645 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000015063 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000014202 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007383 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012623 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000030591 | 3 retrocopies |
retro_rnor_1268, retro_rnor_1348, retro_rnor_1950 ,
|
| Rattus norvegicus | ENSRNOG00000033155 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000048089 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013992 | 2 retrocopies | |
| Tetraodon nigroviridis | ENSTNIG00000011685 | 1 retrocopy |