RetrogeneDB ID: | retro_rnor_2284 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 6:46891155..46891532(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Mrps10 | ||
Ensembl ID: | ENSRNOG00000022609 | ||
Aliases: | None | ||
Description: | 28S ribosomal protein S10, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q7TQ82] |
Percent Identity: | 84.25 % |
Parental protein coverage: | 81.29 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | LSILVKAHDKAVLDSYEYFAVLAAKELGLSIKVHEPPRKI-ERFTLLKSVHIFKKHRVQYEMRTLYRCLE |
.S.LVK.HDKAVLDS.EYFAVLAAKELG.SIKV.EPPRK..E.FTLLKSVHIFKKHRVQYEMR.LYRCLE | |
Retrocopy | MSVLVKVHDKAVLDSSEYFAVLAAKELGISIKVDEPPRKM<ECFTLLKSVHIFKKHRVQYEMRMLYRCLE |
Parental | LKHLTGCTANVYLEYIQRNLPEGVAMEVTKTQIQQLPEHIKEPMWETVSGEKEETKS |
LKHLTGCTAN.YLEYIQRNLPEGVA.EV.K..IQQLPE..KEPMWETVS.EKEE.K. | |
Retrocopy | LKHLTGCTANIYLEYIQRNLPEGVATEVIKS*IQQLPEDSKEPMWETVSEEKEESKA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 5 .10 RPM |
SRP017611_kidney | 0 .00 RPM | 6 .42 RPM |
SRP017611_liver | 0 .00 RPM | 3 .70 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000001638 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000006109 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000006067 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000002081 | 1 retrocopy | |
Homo sapiens | ENSG00000048544 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012808 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000011379 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014661 | 1 retrocopy | |
Mus musculus | ENSMUSG00000034729 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000004800 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016697 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016613 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018169 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000022609 | 1 retrocopy |
retro_rnor_2284 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000027016 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014063 | 1 retrocopy |