RetrogeneDB ID: | retro_rnor_766 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 10:83663812..83664048(-) | ||
Located in intron of: | ENSRNOG00000006500 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Psmg4 | ||
Ensembl ID: | ENSRNOG00000039265 | ||
Aliases: | Psmg4, RGD1305541 | ||
Description: | proteasome (prosome, macropain) assembly chaperone 4 [Source:RefSeq peptide;Acc:NP_001123351] |
Percent Identity: | 77.5 % |
Parental protein coverage: | 65.29 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | PHLRNLAVAMCSRFDSIPVCTSLFGDTSDTTSTGLAQRLAR-KTSKQVFVSYNLSNTDSNFTLLVENRIK |
P.L.NLAVAMCSR.DSIPV.T.LFGDTSDTTS.GL...LAR.KTSKQV.VSYNLSNTDS..TLL.E.RIK | |
Retrocopy | PYLSNLAVAMCSRYDSIPVGTPLFGDTSDTTSMGLPLHLAR<KTSKQVLVSYNLSNTDSDLTLLIEARIK |
Parental | EEMETFPEKF |
EE.ETF.E.F | |
Retrocopy | EETETFRERF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 5 .82 RPM |
SRP017611_kidney | 0 .07 RPM | 6 .49 RPM |
SRP017611_liver | 0 .00 RPM | 5 .85 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014430 | 1 retrocopy | |
Bos taurus | ENSBTAG00000031249 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000024906 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000039265 | 2 retrocopies |
retro_rnor_1442, retro_rnor_766 ,
|
Sus scrofa | ENSSSCG00000001005 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000006146 | 2 retrocopies |