RetrogeneDB ID: | retro_rnor_766 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 10:83663812..83664048(-) | ||
| Located in intron of: | ENSRNOG00000006500 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Psmg4 | ||
| Ensembl ID: | ENSRNOG00000039265 | ||
| Aliases: | Psmg4, RGD1305541 | ||
| Description: | proteasome (prosome, macropain) assembly chaperone 4 [Source:RefSeq peptide;Acc:NP_001123351] |
| Percent Identity: | 77.5 % |
| Parental protein coverage: | 65.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | PHLRNLAVAMCSRFDSIPVCTSLFGDTSDTTSTGLAQRLAR-KTSKQVFVSYNLSNTDSNFTLLVENRIK |
| P.L.NLAVAMCSR.DSIPV.T.LFGDTSDTTS.GL...LAR.KTSKQV.VSYNLSNTDS..TLL.E.RIK | |
| Retrocopy | PYLSNLAVAMCSRYDSIPVGTPLFGDTSDTTSMGLPLHLAR<KTSKQVLVSYNLSNTDSDLTLLIEARIK |
| Parental | EEMETFPEKF |
| EE.ETF.E.F | |
| Retrocopy | EETETFRERF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .82 RPM |
| SRP017611_kidney | 0 .07 RPM | 6 .49 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .85 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014430 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000031249 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000024906 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000039265 | 2 retrocopies |
retro_rnor_1442, retro_rnor_766 ,
|
| Sus scrofa | ENSSSCG00000001005 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006146 | 2 retrocopies |