RetrogeneDB ID: | retro_shar_812 | ||
Retrocopy location | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL865182.1:199794..200002(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSHAG00000000550 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.75 % |
| Parental protein coverage: | 52.55 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLP-GNFLIAGSWANDVRCWEVQDNGQTIPKAQ |
| GTS.FG...T....PMKDIEVT.S.D..IGCL.FS.P.LP.G.F.I..SW.ND.RCWEV.DNGQTIPK.Q | |
| Retrocopy | GTSGFGNSGTSK--PMKDIEVTASSDNGIGCLYFSLPILP>GTF-ITESWVNDIRCWEVHDNGQTIPKIQ |
| Parental | QMH |
| Q.H | |
| Retrocopy | QTH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Oryctolagus cuniculus | ENSOCUG00000001585 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000014649 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000000228 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000000550 | 1 retrocopy |
retro_shar_812 ,
|
| Sarcophilus harrisii | ENSSHAG00000002438 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000010372 | 1 retrocopy |