RetrogeneDB ID: | retro_sscr_268 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 11:60569055..60569451(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AP3S2 | ||
Ensembl ID: | ENSSSCG00000030174 | ||
Aliases: | None | ||
Description: | adaptor-related protein complex 3, sigma 2 subunit [Source:HGNC Symbol;Acc:571] |
Percent Identity: | 79.55 % |
Parental protein coverage: | 68.39 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | ETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFEN |
ETFH.V.KRD...CNFLE.G.LIGG.D.KLIYRHYATLYF.FC.DSSESELGILDLIQVFVETLDKCFEN | |
Retrocopy | ETFHFVSKRDEKVCNFLE*GLLIGGPDNKLIYRHYATLYFIFCIDSSESELGILDLIQVFVETLDKCFEN |
Parental | VCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNKLEKSEGGLSAAPARAVSAV |
.CELDLIFH.DKVH.IL.E..M.G.VLETNMNEIV.QI.AQ.KLEKSE.GL..APA.AVS.V | |
Retrocopy | ICELDLIFHVDKVHNILAEMTMQGVVLETNMNEIVTQIDAQSKLEKSEAGLAGAPAHAVSVV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 1 .33 RPM | 24 .82 RPM |
SRP014902_testis | 0 .42 RPM | 31 .40 RPM |
SRP018288_heart | 0 .58 RPM | 18 .96 RPM |
SRP018288_kidney | 0 .59 RPM | 57 .53 RPM |
SRP018288_liver | 0 .00 RPM | 34 .38 RPM |
SRP018288_lung | 0 .71 RPM | 31 .77 RPM |
SRP018856_adipose | 0 .75 RPM | 46 .77 RPM |
SRP035408_brain | 3 .14 RPM | 30 .20 RPM |
SRP035408_liver | 1 .17 RPM | 28 .62 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000001407 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000003359 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000004247 | 1 retrocopy | |
Equus caballus | ENSECAG00000024044 | 1 retrocopy | |
Felis catus | ENSFCAG00000028122 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000003421 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019522 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011780 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000030982 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000043141 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030174 | 7 retrocopies |
retro_sscr_1109, retro_sscr_199, retro_sscr_268 , retro_sscr_339, retro_sscr_620, retro_sscr_721, retro_sscr_753,
|
Tursiops truncatus | ENSTTRG00000015554 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000008668 | 1 retrocopy |