RetrogeneDB ID: | retro_tbel_4408 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_81332:8625..8840(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C6orf57 | ||
Ensembl ID: | ENSTBEG00000004344 | ||
Aliases: | None | ||
Description: | chromosome 6 open reading frame 57 [Source:HGNC Symbol;Acc:20957] |
Percent Identity: | 72.73 % |
Parental protein coverage: | 71.7 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | FGRLPASARRAARSRPLYHSLRKTSSSQERNPEPVKQSLK-KPKLPEGRFDAPEDSNLEKEPLEKFPDDI |
.G...A.ARR..RS..L.HSLRKTSS.QERNPEPVKQ.LK..PKLP.G.FD.PEDSNLEK.PLEKFPDD. | |
Retrocopy | YGCALATARRVTRSHLLCHSLRKTSS-QERNPEPVKQPLK<EPKLPKGHFDVPEDSNLEKKPLEKFPDD- |
Parental | NPVTKEK |
..VTKEK | |
Retrocopy | --VTKEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002602 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000011410 | 6 retrocopies | |
Erinaceus europaeus | ENSEEUG00000011260 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000011154 | 1 retrocopy | |
Felis catus | ENSFCAG00000026799 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000028087 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000004344 | 2 retrocopies |
retro_tbel_3788, retro_tbel_4408 ,
|
Tarsius syrichta | ENSTSYG00000001769 | 1 retrocopy |