RetrogeneDB ID: | retro_tbel_4408 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_81332:8625..8840(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C6orf57 | ||
| Ensembl ID: | ENSTBEG00000004344 | ||
| Aliases: | None | ||
| Description: | chromosome 6 open reading frame 57 [Source:HGNC Symbol;Acc:20957] |
| Percent Identity: | 72.73 % |
| Parental protein coverage: | 71.7 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | FGRLPASARRAARSRPLYHSLRKTSSSQERNPEPVKQSLK-KPKLPEGRFDAPEDSNLEKEPLEKFPDDI |
| .G...A.ARR..RS..L.HSLRKTSS.QERNPEPVKQ.LK..PKLP.G.FD.PEDSNLEK.PLEKFPDD. | |
| Retrocopy | YGCALATARRVTRSHLLCHSLRKTSS-QERNPEPVKQPLK<EPKLPKGHFDVPEDSNLEKKPLEKFPDD- |
| Parental | NPVTKEK |
| ..VTKEK | |
| Retrocopy | --VTKEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002602 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000011410 | 6 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000011260 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000011154 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026799 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000028087 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000004344 | 2 retrocopies |
retro_tbel_3788, retro_tbel_4408 ,
|
| Tarsius syrichta | ENSTSYG00000001769 | 1 retrocopy |