RetrogeneDB ID: | retro_tbel_4419 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_81953:3915..4154(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF5A2 | ||
Ensembl ID: | ENSTBEG00000000408 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 5A2 [Source:HGNC Symbol;Acc:3301] |
Percent Identity: | 90.12 % |
Parental protein coverage: | 51.95 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | STHNMDVPNIKRND-YQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVLCAMSE |
S.HNMDVPNIKRND.YQLI.IQDGYLSLLTET.EVREDLKLPEGELG.EIEGKY..GED.QVSVLCAMSE | |
Retrocopy | SQHNMDVPNIKRND<YQLIHIQDGYLSLLTETREVREDLKLPEGELGQEIEGKYSVGEDGQVSVLCAMSE |
Parental | EHAVAVEPCKQ |
EHAVAVEPCKQ | |
Retrocopy | EHAVAVEPCKQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005363 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012594 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000014801 | 2 retrocopies | |
Homo sapiens | ENSG00000163577 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000007473 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016657 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015621 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008130 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000000408 | 2 retrocopies |
retro_tbel_1442, retro_tbel_4419 ,
|