RetrogeneDB ID: | retro_dnov_268 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_3155:273124..273557(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF5A2 | ||
Ensembl ID: | ENSDNOG00000014801 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 5A2 [Source:HGNC Symbol;Acc:3301] |
Percent Identity: | 62.91 % |
Parental protein coverage: | 98.03 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MADEIDFTTGDA-GASST-YPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKK |
MAD..DF..GD..GAS.T..P.QC.ALRK.GFVVLK..P..IVEM.T.KTG.H.HA.VHLVGI.IFTGKK | |
Retrocopy | MADDLDFERGDK<GASAT<LPKQCLALRKKGFVVLKEQPRRIVEMPTAKTGQHSHARVHLVGIEIFTGKK |
Parental | YEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQSAMC |
Y..ICPST.NMDVPNIKR.D.Q...IQ.GYLSLL...GEVREDL.LPEG.LG.E.E....A......... | |
Retrocopy | YGAICPSTYNMDVPNIKRKDFQRTDIQNGYLSLLQGSGEVREDLRLPEGDLGQETELRSDA----EHGAV |
Parental | AMSEEYAVAIK |
A..EE.A.AI. | |
Retrocopy | AVTEEAAAAIQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 3 .89 RPM |
SRP012922_cerebellum | 0 .00 RPM | 2 .34 RPM |
SRP012922_heart | 0 .00 RPM | 0 .23 RPM |
SRP012922_kidney | 0 .00 RPM | 0 .55 RPM |
SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
SRP012922_lung | 0 .00 RPM | 1 .37 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 0 .35 RPM |
SRP012922_spleen | 0 .00 RPM | 1 .49 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005363 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012594 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000014801 | 2 retrocopies |
retro_dnov_1133, retro_dnov_268 ,
|
Homo sapiens | ENSG00000163577 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000013225 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000007473 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000022880 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005292 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016657 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014294 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000015621 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008130 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000000408 | 2 retrocopies |