RetrogeneDB ID: | retro_tsyr_888 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
Coordinates: | scaffold_23063:8153..8381(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSTSYG00000006338 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.32 % |
Parental protein coverage: | 74.51 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQ |
RNGRKT.TTVQG...D..KKK.VKAFKKKFAC.GTVIE.PEYGEVIQLQGDQ.KNI.QFLLE....K..Q | |
Retrocopy | RNGRKTFTTVQGMGNDCNKKKPVKAFKKKFACSGTVIELPEYGEVIQLQGDQPKNI*QFLLEIRLTKDDQ |
Parental | LKVHGF |
L.VHGF | |
Retrocopy | LEVHGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dipodomys ordii | ENSDORG00000013689 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000017295 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000013223 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000017704 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000011056 | 2 retrocopies | |
Mus musculus | ENSMUSG00000006941 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000025224 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000012168 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013185 | 6 retrocopies | |
Tarsius syrichta | ENSTSYG00000006338 | 3 retrocopies |
retro_tsyr_1574, retro_tsyr_2154, retro_tsyr_888 ,
|