RetrogeneDB ID: | retro_vpac_84 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | GeneScaffold_1636:446525..446741(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSVPAG00000005953 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 59.72 % |
| Parental protein coverage: | 60.87 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | MVQRLTYRRKLSYTAS-NKTRLARTPGNRIFYLYTKK-GKAPKSACGLCPGRLRGVRAVRPKVLMRLSKT |
| .VQ..T....L.Y.A...K.R..RT.GNRI...YTKK.GKAPKS.CG.CPGRL.GVR.VR.KV.MRL.KT | |
| Retrocopy | LVQLMT*GHRLAYNATCTKNRVSRTLGNRIVCFYTKKVGKAPKSTCGACPGRL*GVRTVRHKVIMRL*KT |
| Parental | KK |
| .. | |
| Retrocopy | RQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |