RetrogeneDB ID: | retro_btau_1004 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 23:16937590..16937972(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RWDD1 | ||
Ensembl ID: | ENSBTAG00000009689 | ||
Aliases: | None | ||
Description: | RWD domain-containing protein 1 [Source:RefSeq peptide;Acc:NP_001029898] |
Percent Identity: | 63.85 % |
Parental protein coverage: | 52.67 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | DQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKK-KRMKEEEQAGKNKLSGR |
..IK.........K.....EAEKQLF.GTP.TI.NFL..KAKFD.ELLE....K.MK..EQAGK.KLSG. | |
Retrocopy | NKIK*NGRSNRNLKTRRRAEAEKQLFYGTPITIQNFLS*KAKFDTELLEMFL<K*MKVKEQAGKSKLSGK |
Parental | QLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDDDDPDYNPADR-ESDLTD |
QLFETDHN.DT..IQFLEDAG..VEVDESL.Q...DL..ED..DDPDYNPAD..ESDLT. | |
Retrocopy | QLFETDHNPDTANIQFLEDAGYSVEVDESLVQKLNDLDPEDKEDDPDYNPADQ<ESDLTN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 39 .00 RPM |
ERP005899_muscle | 0 .00 RPM | 34 .31 RPM |
SRP017611_brain | 0 .00 RPM | 17 .95 RPM |
SRP017611_kidney | 0 .00 RPM | 34 .97 RPM |
SRP017611_liver | 0 .00 RPM | 21 .22 RPM |
SRP030211_testis | 0 .00 RPM | 125 .95 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005692 | 1 retrocopy | |
Bos taurus | ENSBTAG00000009689 | 1 retrocopy |
retro_btau_1004 ,
|
Callithrix jacchus | ENSCJAG00000004474 | 1 retrocopy | |
Equus caballus | ENSECAG00000006587 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000019085 | 3 retrocopies | |
Loxodonta africana | ENSLAFG00000008170 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017837 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000013592 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000005016 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000020231 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000022124 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002543 | 2 retrocopies |