RetrogeneDB ID: | retro_mdom_1686 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 6:201826027..201826388(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMODG00000013377 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RWDD1 | ||
| Ensembl ID: | ENSMODG00000017837 | ||
| Aliases: | None | ||
| Description: | RWD domain containing 1 [Source:HGNC Symbol;Acc:20993] |
| Percent Identity: | 85.25 % |
| Parental protein coverage: | 50.42 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MTDYSEEQRNELEALESIYPDSFTVLSE-NPTCFTITVTSEAGENDETVQTTLKFTYGEKYPDEMPRYEI |
| .T.YSEEQ..ELEALES.Y..S.TV.S..NPT.FTIT.TSEAGENDETVQ.TLKFTYGEKYPDEMPRYEI | |
| Retrocopy | ITNYSEEQHKELEALESSYLNS-TV*SK>NPTNFTITMTSEAGENDETVQITLKFTYGEKYPDEMPRYEI |
| Parental | FSQENLEDNDVSDIVKLLELQAEENLGMVMIFTLVSAVQEKLNEIVDQIKTR |
| FS.ENLEDNDVSDI.KLLELQ.EEN.GMVMIFTLVSAVQEKLNEIVDQIKTR | |
| Retrocopy | FSEENLEDNDVSDILKLLELQTEENHGMVMIFTLVSAVQEKLNEIVDQIKTR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005692 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000009689 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004474 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007516 | 1 retrocopy | |
| Equus caballus | ENSECAG00000006587 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000019085 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000008170 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017837 | 1 retrocopy |
retro_mdom_1686 ,
|
| Oryctolagus cuniculus | ENSOCUG00000013592 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005016 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020231 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000022124 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002543 | 2 retrocopies |