RetrogeneDB ID: | retro_btau_1313 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 4:24797834..24798065(+) | ||
| Located in intron of: | ENSBTAG00000015073 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM5 | ||
| Ensembl ID: | ENSBTAG00000002332 | ||
| Aliases: | None | ||
| Description: | U6 snRNA-associated Sm-like protein LSm5 [Source:UniProtKB/Swiss-Prot;Acc:Q2HJH0] |
| Percent Identity: | 84.62 % |
| Parental protein coverage: | 85.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD |
| MAAN.TTNPSQLLP.ELVDKCI.SRI.IVM.SDKEIVGTL.GFD.F..MVLEDVTEFE.TP.G.RITKLD | |
| Retrocopy | MAANSTTNPSQLLPQELVDKCIASRIRIVMQSDKEIVGTLQGFDGFGTMVLEDVTEFEVTPQG-RITKLD |
| Parental | QILLNGNN |
| QILLNGNN | |
| Retrocopy | QILLNGNN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 13 .70 RPM |
| ERP005899_muscle | 0 .00 RPM | 6 .28 RPM |
| SRP017611_brain | 0 .00 RPM | 6 .49 RPM |
| SRP017611_kidney | 0 .00 RPM | 8 .59 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .32 RPM |
| SRP030211_testis | 0 .00 RPM | 10 .20 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002332 | 3 retrocopies |
retro_btau_1012, retro_btau_1123, retro_btau_1313 ,
|
| Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
| Loxodonta africana | ENSLAFG00000029579 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091625 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000015268 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013892 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000009786 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000004876 | 11 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004237 | 3 retrocopies |