RetrogeneDB ID: | retro_ogar_3062 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873707.1:1682430..1682631(-) | ||
| Located in intron of: | ENSOGAG00000029817 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM5 | ||
| Ensembl ID: | ENSOGAG00000013892 | ||
| Aliases: | None | ||
| Description: | LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17162] |
| Percent Identity: | 74.29 % |
| Parental protein coverage: | 76.92 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | IGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV |
| I...I..VMKS.KEI.G.LLGFDDFV.MVLEDVTE...TPEG.RITKLD.I.LNGN.ITMLV..GEGPEV | |
| Retrocopy | IETSIYTVMKSNKEIAGPLLGFDDFVSMVLEDVTE-KMTPEG-RITKLDLIPLNGNDITMLV-SGEGPEV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006700 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002332 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000010421 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018445 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
| Loxodonta africana | ENSLAFG00000029579 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091625 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000015268 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013892 | 3 retrocopies |
retro_ogar_2727, retro_ogar_3062 , retro_ogar_881,
|
| Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000019057 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000009786 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000004876 | 11 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004237 | 3 retrocopies |