RetrogeneDB ID: | retro_btau_219 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 4:94432193..94432409(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000047845 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5I | ||
| Ensembl ID: | ENSBTAG00000017496 | ||
| Aliases: | None | ||
| Description: | ATP synthase subunit e, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q00361] |
| Percent Identity: | 95.77 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MVPPVQVSPLIKLGRYSALFLGMAYGAKRYNYLKPRAEEERRLAAEEKKKRDEQKRIERELAEAQEDTIL |
| MVPPVQVSPLIKLGRYS.LFLGMAYGAKRYNYLKPRAEEE.RLAAEEK.KRDEQKRIERELAEAQEDTIL | |
| Retrocopy | MVPPVQVSPLIKLGRYSTLFLGMAYGAKRYNYLKPRAEEEKRLAAEEKRKRDEQKRIERELAEAQEDTIL |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 9 .73 RPM |
| ERP005899_muscle | 0 .05 RPM | 126 .48 RPM |
| SRP017611_brain | 0 .14 RPM | 27 .77 RPM |
| SRP017611_kidney | 0 .24 RPM | 55 .30 RPM |
| SRP017611_liver | 0 .23 RPM | 28 .77 RPM |
| SRP030211_testis | 0 .22 RPM | 53 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000017496 | 2 retrocopies |
retro_btau_1222, retro_btau_219 ,
|
| Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |