RetrogeneDB ID: | retro_cjac_352 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 20:2428089..2428305(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000023015 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000001989 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 94.37 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAPPVQVSPLIKLGRYSFLFLGMAYGATRYSYLKPRAEEERRIAAEEKKKQDELKRIAKELAE--EDTIL |
MAPPVQVS.LIKLGRYSFLFLGMAYGATRYSYLKPRAEEER.IAAEEKKKQDELKRIAKELAE..EDTIL | |
Retrocopy | MAPPVQVSRLIKLGRYSFLFLGMAYGATRYSYLKPRAEEERGIAAEEKKKQDELKRIAKELAEAQEDTIL |
Parental | K |
K | |
Retrocopy | K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .42 RPM | 6 .08 RPM |
SRP051959_heart | 0 .61 RPM | 10 .07 RPM |
SRP051959_kidney | 0 .58 RPM | 7 .77 RPM |
SRP051959_liver | 0 .71 RPM | 9 .51 RPM |
SRP051959_lung | 0 .13 RPM | 2 .86 RPM |
SRP051959_lymph_node | 0 .32 RPM | 2 .72 RPM |
SRP051959_skeletal_muscle | 0 .68 RPM | 12 .23 RPM |
SRP051959_spleen | 0 .19 RPM | 3 .45 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy |
retro_cjac_352 ,
|
Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy | |
Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |