RetrogeneDB ID: | retro_cpor_98 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_1:38772468..38772684(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCPOG00000008681 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCPOG00000008678 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 98.59 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MVPPVQVSPLIKLGRYSALVVGIAYGAKRYSYLKPRAEEERRVAEEEKKRQDELKRIERELAEAQDDSIL |
MVPPVQVSPLIKLGRYSALVVGIAYGAKRYSYLKPRAEEERRVAEEEKKRQDELKRIERELAEA.DDSIL | |
Retrocopy | MVPPVQVSPLIKLGRYSALVVGIAYGAKRYSYLKPRAEEERRVAEEEKKRQDELKRIERELAEARDDSIL |
Parental | K |
K | |
Retrocopy | K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .35 RPM | 39 .74 RPM |
SRP017611_kidney | 0 .31 RPM | 85 .53 RPM |
SRP017611_liver | 0 .04 RPM | 47 .84 RPM |
SRP040447_lung | 0 .10 RPM | 22 .42 RPM |
SRP040447_skeletal_muscle | 0 .47 RPM | 112 .52 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy |
retro_cpor_98 ,
|
Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |