RetrogeneDB ID: | retro_mmus_3152 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 8:85824329..85824542(+) | ||
| Located in intron of: | ENSMUSG00000031703 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Atp5k | ||
| Ensembl ID: | ENSMUSG00000050856 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial F1F0 complex, subunit e [Source:MGI Symbol;Acc:MGI:106636] |
| Percent Identity: | 94.37 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MVPPVQVSPLIKFGRYSALIIGMAYGAKRYSYLKPRAEEERRIAAEEKKRLDELKRIERELAEAQDDSIL |
| MVP.VQVSPLIKFGRYSALI.GMA.GAKRYSYLKP.AEEERRIAAEEKKRLDELKRIERELAEAQDDSIL | |
| Retrocopy | MVPLVQVSPLIKFGRYSALILGMA*GAKRYSYLKPLAEEERRIAAEEKKRLDELKRIERELAEAQDDSIL |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .07 RPM | 58 .85 RPM |
| SRP007412_cerebellum | 0 .17 RPM | 61 .05 RPM |
| SRP007412_heart | 0 .37 RPM | 401 .11 RPM |
| SRP007412_kidney | 0 .10 RPM | 172 .28 RPM |
| SRP007412_liver | 0 .19 RPM | 137 .80 RPM |
| SRP007412_testis | 0 .09 RPM | 27 .03 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_144963 | 315 libraries | 295 libraries | 433 libraries | 25 libraries | 4 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050856 | 1 retrocopy |
retro_mmus_3152 ,
|
| Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |