RetrogeneDB ID: | retro_btau_507 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 13:7079810..7080037(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7A2 | ||
Ensembl ID: | ENSBTAG00000005096 | ||
Aliases: | None | ||
Description: | Cytochrome c oxidase subunit 7A2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P13184] |
Percent Identity: | 67.53 % |
Parental protein coverage: | 91.57 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MLRNLLALRQIAKRTISTSSRRQFENKVPEKQKLFQEDNGIPVHLKGGIADAL-LYRATMILTVGGTAYA |
ML.NL..L.QIA.RT.S..S.RQFENKV.EKQKLFQE.N.IPVH.KGG.ADAL..YRAT.ILTV.GTA.A | |
Retrocopy | MLQNLQTLGQIAQRTVSIDSHRQFENKVSEKQKLFQEYNRIPVHVKGGKADAL<WYRATLILTVDGTADA |
Parental | MYELAVA |
...L... | |
Retrocopy | SCGLYIS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 5 .34 RPM |
ERP005899_muscle | 0 .00 RPM | 76 .33 RPM |
SRP017611_brain | 0 .00 RPM | 24 .94 RPM |
SRP017611_kidney | 0 .00 RPM | 59 .51 RPM |
SRP017611_liver | 0 .00 RPM | 14 .20 RPM |
SRP030211_testis | 0 .00 RPM | 107 .49 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014453 | 1 retrocopy | |
Bos taurus | ENSBTAG00000005096 | 6 retrocopies |
retro_btau_1071, retro_btau_1230, retro_btau_1436, retro_btau_1469, retro_btau_1703, retro_btau_507 ,
|
Callithrix jacchus | ENSCJAG00000010305 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000007404 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000015425 | 2 retrocopies | |
Homo sapiens | ENSG00000112695 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000005865 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000002313 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000015747 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004949 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000016781 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000010401 | 6 retrocopies | |
Rattus norvegicus | ENSRNOG00000042903 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000004480 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002536 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000007294 | 7 retrocopies | |
Tursiops truncatus | ENSTTRG00000007874 | 1 retrocopy |