RetrogeneDB ID: | retro_mmur_799 | ||
Retrocopy location | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | GeneScaffold_975:185871..186126(+) | ||
| Located in intron of: | ENSMICG00000003946 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7A2 | ||
| Ensembl ID: | ENSMICG00000015747 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIa polypeptide 2 (liver) [Source:HGNC Symbol;Acc:2288] |
| Percent Identity: | 64.71 % |
| Parental protein coverage: | 73.91 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AKMLRNLLGLRQIAQRTISTASRRHFENKVPEKQKLFQEDDGIPVHLKGGVADAILYRLTMVLTVGGTAY |
| A..L.NLL.L...AQRTI.T.S.RH.EN.VPEKQKLF.ED.GIPVHL.GG.AD...Y...MVLT.GGTA. | |
| Retrocopy | ARILWNLLALGPTAQRTINTTSHRHLENEVPEKQKLFWEDNGIPVHLTGGIADVFPYGVIMVLTGGGTAD |
| Parental | AIYQLAVASFPKKQD |
| .I....VASF.KKQD | |
| Retrocopy | DIHRPTVASFFKKQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014453 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000005096 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000010305 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000007404 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000015425 | 2 retrocopies | |
| Homo sapiens | ENSG00000112695 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005865 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000002313 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015747 | 3 retrocopies |
retro_mmur_381, retro_mmur_548, retro_mmur_799 ,
|
| Nomascus leucogenys | ENSNLEG00000004949 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016781 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000010401 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042903 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000004480 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002536 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000007294 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007874 | 1 retrocopy |